ATP1B4 (NM_012069) Human Recombinant Protein

  • Product Brand Image
SKU
TP324408
Recombinant protein of human ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2, 20 µg
In Control Promo
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224408 representing NM_012069
Red=Cloning site Green=Tags(s)

MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEE
EEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGLILLIYFFFYASLAAVITLCMYTLFLTISPYIPT
FTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNED
EDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISY
YPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLN
IET

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036201
Locus ID 23439
UniProt ID Q9UN42
Cytogenetics Xq24
RefSeq Size 3857
RefSeq ORF 1059
Summary This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Mar 2010
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Cardiac muscle contraction
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "ATP1B4" proteins (3)
SKU Description Size Price
PH324408 ATP1B4 MS Standard C13 and N15-labeled recombinant protein (NP_036201) 10 ug
$3,360.00
LC415995 ATP1B4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415995 Transient overexpression lysate of ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.