ATP1B4 (NM_012069) Human Mass Spec Standard

SKU
PH324408
ATP1B4 MS Standard C13 and N15-labeled recombinant protein (NP_036201)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224408]
Predicted MW 40.9 kDa
Protein Sequence
Protein Sequence
>RC224408 representing NM_012069
Red=Cloning site Green=Tags(s)

MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEE
EEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGLILLIYFFFYASLAAVITLCMYTLFLTISPYIPT
FTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNED
EDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISY
YPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLN
IET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036201
RefSeq Size 3857
RefSeq ORF 1059
Locus ID 23439
UniProt ID Q9UN42
Cytogenetics Xq24
Summary This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Protein Families Transmembrane
Protein Pathways Cardiac muscle contraction
Write Your Own Review
You're reviewing:ATP1B4 (NM_012069) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415995 ATP1B4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415995 Transient overexpression lysate of ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2 100 ug
$436.00
TP324408 Recombinant protein of human ATPase, (Na+)/K+ transporting, beta 4 polypeptide (ATP1B4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.