Annexin A11 (ANXA11) (NM_145869) Human Recombinant Protein

SKU
TP323654
Recombinant protein of human annexin A11 (ANXA11), transcript variant c, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223654 representing NM_145869
Red=Cloning site Green=Tags(s)

MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM
PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP
PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR
KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE
IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST
NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE
GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS
GDYRKILLKICGGND

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_665876
Locus ID 311
UniProt ID P50995
Cytogenetics 10q22.3
RefSeq Size 2731
RefSeq ORF 1515
Synonyms ALS23; ANX11; CAP-50; CAP50
Summary This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:Annexin A11 (ANXA11) (NM_145869) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303530 ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665875) 10 ug
$3,255.00
PH312191 ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148) 10 ug
$3,255.00
PH323654 ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665876) 10 ug
$3,255.00
LC403443 ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407850 ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420097 ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403443 Transient overexpression lysate of annexin A11 (ANXA11), transcript variant c 100 ug
$665.00
LY407850 Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b 100 ug
$436.00
LY420097 Transient overexpression lysate of annexin A11 (ANXA11), transcript variant a 100 ug
$436.00
TP303530 Recombinant protein of human annexin A11 (ANXA11), transcript variant b, 20 µg 20 ug
$737.00
TP312191 Recombinant protein of human annexin A11 (ANXA11), transcript variant a, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.