Annexin A11 (ANXA11) (NM_145868) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203530] |
Predicted MW | 54.4 kDa |
Protein Sequence |
Protein Sequence
>RC203530 protein sequence
Red=Cloning site Green=Tags(s) MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS GDYRKILLKICGGND myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_665875 |
RefSeq Size | 2535 |
RefSeq ORF | 1515 |
Synonyms | ALS23; ANX11; CAP-50; CAP50 |
Locus ID | 311 |
UniProt ID | P50995 |
Cytogenetics | 10q22.3 |
Summary | This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312191 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148) | 10 ug |
$3,255.00
|
|
PH323654 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665876) | 10 ug |
$3,255.00
|
|
LC403443 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC407850 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420097 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403443 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant c | 100 ug |
$665.00
|
|
LY407850 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b | 100 ug |
$436.00
|
|
LY420097 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant a | 100 ug |
$436.00
|
|
TP303530 | Recombinant protein of human annexin A11 (ANXA11), transcript variant b, 20 µg | 20 ug |
$737.00
|
|
TP312191 | Recombinant protein of human annexin A11 (ANXA11), transcript variant a, 20 µg | 20 ug |
$737.00
|
|
TP323654 | Recombinant protein of human annexin A11 (ANXA11), transcript variant c, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.