Annexin A11 (ANXA11) (NM_001157) Human Mass Spec Standard

SKU
PH312191
ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212191]
Predicted MW 54.4 kDa
Protein Sequence
Protein Sequence
>RC212191 protein sequence
Red=Cloning site Green=Tags(s)

MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM
PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP
PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR
KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE
IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST
NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE
GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS
GDYRKILLKICGGND

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001148
RefSeq Size 2486
RefSeq ORF 1515
Synonyms ALS23; ANX11; CAP-50; CAP50
Locus ID 311
UniProt ID P50995
Cytogenetics 10q22.3
Summary This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:Annexin A11 (ANXA11) (NM_001157) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303530 ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665875) 10 ug
$3,255.00
PH323654 ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665876) 10 ug
$3,255.00
LC403443 ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407850 ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420097 ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403443 Transient overexpression lysate of annexin A11 (ANXA11), transcript variant c 100 ug
$665.00
LY407850 Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b 100 ug
$436.00
LY420097 Transient overexpression lysate of annexin A11 (ANXA11), transcript variant a 100 ug
$436.00
TP303530 Recombinant protein of human annexin A11 (ANXA11), transcript variant b, 20 µg 20 ug
$737.00
TP312191 Recombinant protein of human annexin A11 (ANXA11), transcript variant a, 20 µg 20 ug
$737.00
TP323654 Recombinant protein of human annexin A11 (ANXA11), transcript variant c, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.