NOR1 (NR4A3) (NM_173200) Human Recombinant Protein
SKU
TP323629
Recombinant protein of human nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 3, 20 µg
$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC223629 representing NM_173200
Red=Cloning site Green=Tags(s) MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIS TFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLP STSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPH PPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASS LLGESPSLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKR RRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDS TPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFV LRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGL KEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKL FLDTLPF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_775292 |
Locus ID | 8013 |
UniProt ID | Q92570 |
Cytogenetics | 9q31.1 |
RefSeq Size | 4983 |
RefSeq ORF | 1911 |
Synonyms | CHN; CSMF; MINOR; NOR1 |
Summary | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH323629 | NR4A3 MS Standard C13 and N15-labeled recombinant protein (NP_775292) | 10 ug |
$3,255.00
|
|
LC406643 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC416280 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429326 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406643 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 2 | 100 ug |
$665.00
|
|
LY416280 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 | 100 ug |
$665.00
|
|
LY429326 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.