NOR1 (NR4A3) (NM_173200) Human Mass Spec Standard

SKU
PH323629
NR4A3 MS Standard C13 and N15-labeled recombinant protein (NP_775292)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223629]
Predicted MW 69.3 kDa
Protein Sequence
Protein Sequence
>RC223629 representing NM_173200
Red=Cloning site Green=Tags(s)

MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIS
TFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLP
STSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPH
PPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASS
LLGESPSLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKR
RRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDS
TPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFV
LRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGL
KEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKL
FLDTLPF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775292
RefSeq Size 4983
RefSeq ORF 1911
Synonyms CHN; CSMF; MINOR; NOR1
Locus ID 8013
UniProt ID Q92570
Cytogenetics 9q31.1
Summary This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Write Your Own Review
You're reviewing:NOR1 (NR4A3) (NM_173200) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406643 NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416280 NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429326 NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406643 Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 2 100 ug
$665.00
LY416280 Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 100 ug
$665.00
LY429326 Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 100 ug
$436.00
TP323629 Recombinant protein of human nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.