Uroplakin II (UPK2) (NM_006760) Human Recombinant Protein

SKU
TP323168
Recombinant protein of human uroplakin 2 (UPK2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223168 protein sequence
Red=Cloning site Green=Tags(s)

MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKV
VTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPR
RNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006751
Locus ID 7379
UniProt ID O00526
Cytogenetics 11q23.3
RefSeq Size 947
RefSeq ORF 552
Synonyms UP2; UPII
Summary This gene encodes one of the proteins of the highly conserved urothelium-specific integral membrane proteins of the asymmetric unit membrane which forms urothelium apical plaques in mammals. The asymmetric unit membrane is believed to strengthen the urothelium by preventing cell rupture during bladder distention. The encoded protein is expressed in the peripheral blood of bladder cancer patients with transitional cell carcinomas.[provided by RefSeq, Sep 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Uroplakin II (UPK2) (NM_006760) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH323168 UPK2 MS Standard C13 and N15-labeled recombinant protein (NP_006751) 10 ug
$3,255.00
LC416439 UPK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416439 Transient overexpression lysate of uroplakin 2 (UPK2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.