Uroplakin II (UPK2) (NM_006760) Human Tagged ORF Clone

SKU
RC223168
UPK2 (Myc-DDK-tagged)-Human uroplakin 2 (UPK2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Uroplakin II
Synonyms UP2; UPII
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223168 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACCCCTGCTGCCCATCCGGACCTTGCCCTTGATCCTGATTCTGCTGGCTCTGCTGTCCCCAGGGG
CTGCAGACTTCAACATCTCAAGCCTCTCTGGTCTGCTGTCCCCGGCACTAACGGAGAGCCTGCTGGTTGC
CTTGCCCCCCTGTCACCTCACAGGAGGCAATGCCACACTGATGGTCCGGAGAGCCAATGACAGCAAAGTG
GTGACGTCCAGCTTTGTGGTGCCTCCGTGCCGTGGGCGCAGGGAACTGGTGAGTGTGGTGGACAGTGGTG
CTGGCTTCACAGTCACTCGGCTCAGTGCATACCAGGTGACAAACCTCGTGCCAGGAACCAAATTCTACAT
TTCCTACCTAGTGAAGAAGGGGACAGCCACTGAGTCCAGCAGAGAGATCCCAATGTCCACACTCCCTCGA
AGGAACATGGAATCCATTGGGCTGGGTATGGCCCGCACAGGGGGCATGGTGGTCATCACGGTGCTGCTCT
CTGTCGCCATGTTCCTGCTGGTGCTGGGCTTCATCATTGCCCTGGCACTGGGCTCCCGCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223168 protein sequence
Red=Cloning site Green=Tags(s)

MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKV
VTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPR
RNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006760
ORF Size 552 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006760.4
RefSeq Size 947 bp
RefSeq ORF 555 bp
Locus ID 7379
UniProt ID O00526
Cytogenetics 11q23.3
Protein Families Transmembrane
MW 19.4 kDa
Summary This gene encodes one of the proteins of the highly conserved urothelium-specific integral membrane proteins of the asymmetric unit membrane which forms urothelium apical plaques in mammals. The asymmetric unit membrane is believed to strengthen the urothelium by preventing cell rupture during bladder distention. The encoded protein is expressed in the peripheral blood of bladder cancer patients with transitional cell carcinomas.[provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:Uroplakin II (UPK2) (NM_006760) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223168L1 Lenti ORF clone of Human uroplakin 2 (UPK2), Myc-DDK-tagged 10 ug
$600.00
RC223168L2 Lenti ORF clone of Human uroplakin 2 (UPK2), mGFP tagged 10 ug
$600.00
RC223168L3 Lenti ORF clone of Human uroplakin 2 (UPK2), Myc-DDK-tagged 10 ug
$600.00
RC223168L4 Lenti ORF clone of Human uroplakin 2 (UPK2), mGFP tagged 10 ug
$600.00
RG223168 UPK2 (tGFP-tagged) - Human uroplakin 2 (UPK2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303820 UPK2 (untagged)-Human uroplakin 2 (UPK2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.