Uroplakin II (UPK2) (NM_006760) Human Mass Spec Standard

SKU
PH323168
UPK2 MS Standard C13 and N15-labeled recombinant protein (NP_006751)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223168]
Predicted MW 19.4 kDa
Protein Sequence
Protein Sequence
>RC223168 protein sequence
Red=Cloning site Green=Tags(s)

MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKV
VTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPR
RNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006751
RefSeq Size 947
RefSeq ORF 552
Synonyms UP2; UPII
Locus ID 7379
UniProt ID O00526
Cytogenetics 11q23.3
Summary This gene encodes one of the proteins of the highly conserved urothelium-specific integral membrane proteins of the asymmetric unit membrane which forms urothelium apical plaques in mammals. The asymmetric unit membrane is believed to strengthen the urothelium by preventing cell rupture during bladder distention. The encoded protein is expressed in the peripheral blood of bladder cancer patients with transitional cell carcinomas.[provided by RefSeq, Sep 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Uroplakin II (UPK2) (NM_006760) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416439 UPK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416439 Transient overexpression lysate of uroplakin 2 (UPK2) 100 ug
$436.00
TP323168 Recombinant protein of human uroplakin 2 (UPK2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.