TRAF4AF1 (KNSTRN) (NM_033286) Human Recombinant Protein

SKU TP322981

Recombinant protein of human chromosome 15 open reading frame 23 (C15orf23), transcript variant 1, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222981 protein sequence; Red=Cloning site Green=Tags(s); ; MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQEADLAGGTTVAAGNLLNESEKDCGQDRRAPG; VQPCLLVTMTSVVKTVYSLQPSSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITK; LRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELL; EKFRDNCLAILESKGLDPALGGETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKL; EMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_150628
• Locus ID: 90417
• UniProt ID: Q9Y448
• Cytogenetics: 15q15.1
• RefSeq Size: 1763
• RefSeq ORF: 948
• Synonyms: C15orf23; HSD11; SKAP; TRAF4AF1
• Summary: Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase (PubMed:19667759). Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture (PubMed:19667759, PubMed:22110139). The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments (PubMed:21402792). Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division (PubMed:23035123). May be involved in UV-induced apoptosis via its interaction with PRPF19; however, these results need additional evidences (PubMed:24718257).[UniProtKB/Swiss-Prot Function]