THYN1 (NM_199297) Human Recombinant Protein

SKU TP322714

Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 2, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222714 protein sequence; Red=Cloning site Green=Tags(s); ; MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG; VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF; EKNNPHYDPSSKEDNPKWSMKSLILF; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_954994
• Locus ID: 29087
• UniProt ID: Q9P016
• Cytogenetics: 11q25
• RefSeq Size: 862
• RefSeq ORF: 498
• Synonyms: HSPC144; MDS012; MY105; THY28; THY28KD
• Summary: This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]