THYN1 (NM_001037305) Human Recombinant Protein

SKU
TP317369
Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 5, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217369 representing NM_001037305
Red=Cloning site Green=Tags(s)

MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG
VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF
EKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQ
EEFDFVLSLEEKEPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001032382
Locus ID 29087
UniProt ID Q9P016
Cytogenetics 11q25
RefSeq Size 941
RefSeq ORF 675
Synonyms HSPC144; MDS012; MY105; THY28; THY28KD
Summary This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:THYN1 (NM_001037305) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316877 THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_054893) 10 ug
$3,255.00
PH317369 THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_001032382) 10 ug
$3,255.00
PH322714 THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_954994) 10 ug
$3,255.00
LC404616 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404617 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415464 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421943 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421944 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404616 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 2 100 ug
$436.00
LY404617 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 3 100 ug
$436.00
LY415464 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 1 100 ug
$436.00
LY421943 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 4 100 ug
$436.00
LY421944 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 5 100 ug
$436.00
TP316877 Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322714 Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.