THYN1 (NM_001037305) Human Mass Spec Standard

SKU
PH317369
THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_001032382)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217369]
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC217369 representing NM_001037305
Red=Cloning site Green=Tags(s)

MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG
VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF
EKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQ
EEFDFVLSLEEKEPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032382
RefSeq Size 941
RefSeq ORF 675
Synonyms HSPC144; MDS012; MY105; THY28; THY28KD
Locus ID 29087
UniProt ID Q9P016
Cytogenetics 11q25
Summary This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:THYN1 (NM_001037305) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316877 THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_054893) 10 ug
$3,255.00
PH322714 THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_954994) 10 ug
$3,255.00
LC404616 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404617 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415464 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421943 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421944 THYN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404616 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 2 100 ug
$436.00
LY404617 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 3 100 ug
$436.00
LY415464 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 1 100 ug
$436.00
LY421943 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 4 100 ug
$436.00
LY421944 Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 5 100 ug
$436.00
TP316877 Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317369 Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322714 Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.