CD36 (NM_001001548) Human Recombinant Protein
CAT#: TP321976
Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221976 protein sequence
Red=Cloning site Green=Tags(s) MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001001548 |
Locus ID | 948 |
UniProt ID | P16671, A4D1B1 |
Cytogenetics | 7q21.11 |
Refseq Size | 4727 |
Refseq ORF | 1416 |
Synonyms | BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3 |
Summary | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, ECM-receptor interaction, Hematopoietic cell lineage, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400018 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424372 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424373 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY400018 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3 |
USD 436.00 |
|
LY424372 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 2 |
USD 665.00 |
|
LY424373 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 |
USD 665.00 |
|
PH303254 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_000063) |
USD 3,255.00 |
|
PH321976 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001001548) |
USD 3,255.00 |
|
PH325799 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120915) |
USD 3,255.00 |
|
PH325800 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120916) |
USD 3,255.00 |
|
TP303254 | Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3, 20 µg |
USD 867.00 |
|
TP325799 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 4, 20 µg |
USD 867.00 |
|
TP325800 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 5, 20 µg |
USD 867.00 |
|
TP710013 | Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36),full length,with C-terminal polyhistidine tag, expressed in sf9 cell |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review