CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein

SKU
TP321943
Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221943 protein sequence
Red=Cloning site Green=Tags(s)

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK
AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL
RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA
ASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNAL
TTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG
STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP
FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_941989
Locus ID 10658
UniProt ID Q92879
Cytogenetics 11p11.2
RefSeq Size 4656
RefSeq ORF 1449
Synonyms BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306275 CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_006551) 10 ug
$3,255.00
PH321943 CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_941989) 10 ug
$3,255.00
LC401964 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404819 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422453 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433163 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433208 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401964 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1 100 ug
$436.00
LY404819 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2 100 ug
$665.00
LY422453 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 3 100 ug
$665.00
LY433163 Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 5 100 ug
$436.00
LY433208 Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 4 100 ug
$436.00
TP306275 Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.