CUG BP1 (CELF1) (NM_198700) Human Mass Spec Standard

SKU
PH321943
CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_941989)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221943]
Predicted MW 51.6 kDa
Protein Sequence
Protein Sequence
>RC221943 protein sequence
Red=Cloning site Green=Tags(s)

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK
AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL
RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA
ASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNAL
TTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG
STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP
FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_941989
RefSeq Size 4656
RefSeq ORF 1449
Synonyms BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR
Locus ID 10658
UniProt ID Q92879
Cytogenetics 11p11.2
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CUG BP1 (CELF1) (NM_198700) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306275 CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_006551) 10 ug
$3,255.00
LC401964 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404819 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422453 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433163 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433208 CELF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401964 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1 100 ug
$436.00
LY404819 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2 100 ug
$665.00
LY422453 Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 3 100 ug
$665.00
LY433163 Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 5 100 ug
$436.00
LY433208 Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 4 100 ug
$436.00
TP306275 Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1, 20 µg 20 ug
$737.00
TP321943 Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.