CUG BP1 (CELF1) (NM_006560) Human Recombinant Protein
SKU
TP306275
Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC206275 protein sequence
Red=Cloning site Green=Tags(s) MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA ASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNAL TTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006551 |
Locus ID | 10658 |
UniProt ID | Q92879 |
Cytogenetics | 11p11.2 |
RefSeq Size | 4711 |
RefSeq ORF | 1449 |
Synonyms | BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR |
Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306275 | CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_006551) | 10 ug |
$3,255.00
|
|
PH321943 | CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_941989) | 10 ug |
$3,255.00
|
|
LC401964 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404819 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422453 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC433163 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC433208 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401964 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1 | 100 ug |
$436.00
|
|
LY404819 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2 | 100 ug |
$665.00
|
|
LY422453 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 3 | 100 ug |
$665.00
|
|
LY433163 | Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 5 | 100 ug |
$436.00
|
|
LY433208 | Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 4 | 100 ug |
$436.00
|
|
TP321943 | Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.