NDRG4 (NM_022910) Human Recombinant Protein
SKU
TP321301
Recombinant protein of human NDRG family member 4 (NDRG4), transcript variant 3, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC221301 representing NM_022910
Red=Cloning site Green=Tags(s) MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGNRPAILTYHD VGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYV IGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNN TELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNS KLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQA CTHSESSEGLGQVNHTMEVSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_075061 |
Locus ID | 65009 |
UniProt ID | Q9ULP0 |
Cytogenetics | 16q21 |
RefSeq Size | 3453 |
RefSeq ORF | 1113 |
Synonyms | BDM1; SMAP-8; SMAP8 |
Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.[provided by RefSeq, Jun 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321058 | NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_065198) | 10 ug |
$3,255.00
|
|
PH321301 | NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_075061) | 10 ug |
$3,255.00
|
|
LC402788 | NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC411459 | NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427222 | NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402788 | Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 1 | 100 ug |
$436.00
|
|
LY411459 | Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 3 | 100 ug |
$436.00
|
|
LY427222 | Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 2 | 100 ug |
$436.00
|
|
TP321058 | Recombinant protein of human NDRG family member 4 (NDRG4), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP761034 | Purified recombinant protein of Human NDRG family member 4 (NDRG4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.