NDRG4 (NM_020465) Human Mass Spec Standard

SKU
PH321058
NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_065198)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221058]
Predicted MW 40.5 kDa
Protein Sequence
Protein Sequence
>RC221058 representing NM_020465
Red=Cloning site Green=Tags(s)

MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGNRPAILTYHD
VGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYV
IGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNN
TELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNS
KLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQA
CTHSESSEGLGQVNHTMEVSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065198
RefSeq Size 3288
RefSeq ORF 1113
Synonyms BDM1; SMAP-8; SMAP8
Locus ID 65009
UniProt ID Q9ULP0
Cytogenetics 16q21
Summary This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.[provided by RefSeq, Jun 2011]
Write Your Own Review
You're reviewing:NDRG4 (NM_020465) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321301 NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_075061) 10 ug
$3,255.00
LC402788 NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411459 NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427222 NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402788 Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 1 100 ug
$436.00
LY411459 Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 3 100 ug
$436.00
LY427222 Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 2 100 ug
$436.00
TP321058 Recombinant protein of human NDRG family member 4 (NDRG4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321301 Recombinant protein of human NDRG family member 4 (NDRG4), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761034 Purified recombinant protein of Human NDRG family member 4 (NDRG4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.