DNAJB12 (NM_017626) Human Recombinant Protein

SKU
TP320679
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220679 protein sequence
Red=Cloning site Green=Tags(s)

MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHAT
HRKAGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPD
KNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGG
GFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
GHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTD
MYHRAQKMGTPSCSRLSEVQASLHG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060096
Locus ID 54788
UniProt ID Q9NXW2
Cytogenetics 10q22.1
RefSeq Size 3215
RefSeq ORF 1125
Synonyms DJ10
Summary DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM, Mar 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:DNAJB12 (NM_017626) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH320679 DNAJB12 MS Standard C13 and N15-labeled recombinant protein (NP_060096) 10 ug
$3,255.00
LC413670 DNAJB12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432222 DNAJB12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413670 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 100 ug
$436.00
LY432222 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.