DNAJB12 (NM_017626) Human Tagged ORF Clone

SKU
RC220679
DNAJB12 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJB12
Synonyms DJ10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220679 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAATCCAACAAGGATGAAGCTGAGCGCTGTATCAGCATCGCCCTCAAGGCCATCCAGAGCAACCAGC
CCGACCGGGCGCTCCGCTTCCTGGAGAAGGCACAGCGGCTGTATCCGACGCCGCGAGTTCGCGCCCTGAT
TGAGTCCCTCAACCAGAAACCACAGACTGCCGGTGACCAACCCCCACCCACAGACACAACCCATGCCACC
CACAGGAAAGCAGGTGGGACCGATGCCCCCTCGGCCAACGGTGAAGCTGGAGGAGAGAGCACCAAAGGCT
ACACTGCAGAACAGGTTGCAGCTGTGAAAAGGGTCAAGCAATGTAAAGATTACTATGAGATCCTGGGGGT
GAGCAGAGGGGCCTCGGATGAGGACCTGAAGAAGGCCTACCGCAGACTGGCCCTCAAATTCCACCCAGAC
AAGAACCACGCACCTGGTGCCACTGAAGCCTTCAAAGCCATTGGCACAGCATATGCGGTACTCAGCAACC
CGGAGAAGAGGAAGCAGTATGACCAGTTCGGCGATGACAAGAGCCAGGCGGCCCGGCACGGCCATGGGCA
TGGGGATTTCCACCGTGGCTTTGAGGCCGACATCTCCCCTGAAGACCTCTTCAACATGTTCTTTGGCGGC
GGCTTCCCTTCTAGTAACGTCCACGTCTACAGCAACGGCCGCATGCGCTATACCTACCAGCAAAGGCAGG
ACCGCAGGGACAACCAGGGTGATGGCGGGCTAGGGGTGTTTGTGCAGCTGATGCCTATCCTCATCCTGAT
TCTCGTGTCAGCTCTCAGCCAGCTCATGGTCTCCAGTCCACCCTACAGTCTGAGTCCAAGACCGTCCGTG
GGCCACATCCACAGGCGAGTCACTGACCACCTGGGTGTCGTCTACTATGTGGGAGACACTTTCTCCGAAG
AGTACACAGGCTCCAGCCTCAAAACAGTCGAGCGGAATGTGGAAGATGATTATATCGCCAACCTCCGGAA
CAACTGCTGGAAGGAGAAGCAGCAGAAGGAAGGCTTGCTGTACCGGGCACGCTACTTTGGCGACACAGAT
ATGTACCACAGAGCACAGAAGATGGGCACCCCCAGCTGCAGCCGACTGTCAGAGGTGCAGGCCTCCCTGC
ATGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220679 protein sequence
Red=Cloning site Green=Tags(s)

MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHAT
HRKAGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPD
KNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGG
GFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
GHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTD
MYHRAQKMGTPSCSRLSEVQASLHG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017626
ORF Size 1125 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017626.6
RefSeq Size 3215 bp
RefSeq ORF 1128 bp
Locus ID 54788
UniProt ID Q9NXW2
Cytogenetics 10q22.1
Domains DnaJ
Protein Families Transmembrane
MW 41.9 kDa
Summary DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:DNAJB12 (NM_017626) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220679L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC220679L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, mGFP tagged 10 ug
$757.00
RC220679L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC220679L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, mGFP tagged 10 ug
$757.00
RC229198 DNAJB12 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 10 ug
$457.00
RC229198L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC229198L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, mGFP tagged 10 ug
$757.00
RG220679 DNAJB12 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 10 ug
$489.00 MSRP $657.00 MSRP $657.00
RG229198 DNAJB12 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC114056 DNAJB12 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 10 ug
$457.00
SC327833 DNAJB12 (untagged)-Human DnaJ (Hsp40) homolog subfamily B member 12 (DNAJB12) transcript variant 2 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.