DNAJB12 (NM_017626) Human Mass Spec Standard

SKU
PH320679
DNAJB12 MS Standard C13 and N15-labeled recombinant protein (NP_060096)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220679]
Predicted MW 41.9 kDa
Protein Sequence
Protein Sequence
>RC220679 protein sequence
Red=Cloning site Green=Tags(s)

MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHAT
HRKAGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPD
KNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGG
GFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
GHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTD
MYHRAQKMGTPSCSRLSEVQASLHG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060096
RefSeq Size 3215
RefSeq ORF 1125
Synonyms DJ10
Locus ID 54788
UniProt ID Q9NXW2
Cytogenetics 10q22.1
Summary DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM, Mar 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:DNAJB12 (NM_017626) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413670 DNAJB12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432222 DNAJB12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413670 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 100 ug
$436.00
LY432222 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 100 ug
$436.00
TP320679 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.