NEU2 (NM_005383) Human Recombinant Protein

CAT#: TP319858

Recombinant protein of human sialidase 2 (cytosolic sialidase) (NEU2), 20 µg

Product Images

NEU2 and NEU3 upregulate TGF-beta1 by PBMC. Human PBMC were incubated with or without recombinant human sialidases, NEU1 (OriGene TP300386), NEU2 (OriGene TP319858), NEU3 (OriGene TP316537), NEU4 (OriGene TP303948) for five days, then air-dried and stained for TGF-beta1. Positive staining appears pink, and counterstaining is blue. Bar is 0.1 mm. Figure cited from Sci Rep, PMID: 29118338

• 

  Coomassie blue staining of purified NEU2 protein (Cat# TP319858). The protein was produced from HEK293T cells transfected with NEU2 cDNA clone (Cat# RC219858) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219858 representing NM_005383
  Red=Cloning site Green=Tags(s)
  
  MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA
  QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR
  DLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH
  FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP
  SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF
  GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Cell treatment (PMID: 29118338)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005374
• Locus ID: 4759
• UniProt ID: Q9Y3R4
• Cytogenetics: 2q37.1
• Refseq Size: 1143
• Refseq ORF: 1140
• Synonyms: SIAL2
• Summary: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq, Jul 2008]
• Protein Pathways: Other glycan degradation, Sphingolipid metabolism