SPINT1 (NM_181642) Human Recombinant Protein
SKU
TP318993
Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC218993 representing NM_181642
Red=Cloning site Green=Tags(s) MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVS NGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINY LTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY GGCLGNKNNYLREEECILACRGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDS FLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKN QRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_857593 |
Locus ID | 6692 |
UniProt ID | O43278 |
Cytogenetics | 15q15.1 |
RefSeq Size | 2484 |
RefSeq ORF | 1587 |
Synonyms | HAI; HAI1; MANSC2 |
Summary | The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303537 | SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_001027539) | 10 ug |
$3,255.00
|
|
PH318993 | SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_857593) | 10 ug |
$3,255.00
|
|
LC405735 | SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422310 | SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405735 | Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1 | 100 ug |
$665.00
|
|
LY422310 | Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3 | 100 ug |
$436.00
|
|
TP303537 | Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.