SPINT1 (NM_181642) Human Mass Spec Standard

SKU
PH318993
SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_857593)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218993]
Predicted MW 54.8 kDa
Protein Sequence
Protein Sequence
>RC218993 representing NM_181642
Red=Cloning site Green=Tags(s)

MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVS
NGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINY
LTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL
WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY
GGCLGNKNNYLREEECILACRGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDS
FLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKN
QRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_857593
RefSeq Size 2484
RefSeq ORF 1587
Synonyms HAI; HAI1; MANSC2
Locus ID 6692
UniProt ID O43278
Cytogenetics 15q15.1
Summary The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:SPINT1 (NM_181642) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303537 SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_001027539) 10 ug
$3,255.00
LC405735 SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422310 SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405735 Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1 100 ug
$665.00
LY422310 Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3 100 ug
$436.00
TP303537 Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3, 20 µg 20 ug
$737.00
TP318993 Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.