SPINT1 (NM_001032367) Human Recombinant Protein

SKU
TP303537
Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203537 protein sequence
Red=Cloning site Green=Tags(s)

MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVS
NGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINY
LTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVEL
WGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVY
GGCLGNKNNYLREEECILACRGVQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDE
AACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQ
CLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVVAILGYCFFKNQRKDFHGHHHHPPPTP
ASSTVSTTEDTEHLVYNHTTRPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001027539
Locus ID 6692
UniProt ID O43278
Cytogenetics 15q15.1
RefSeq Size 2342
RefSeq ORF 1539
Synonyms HAI; HAI1; MANSC2
Summary The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured tissues. Alternative splicing results in multiple variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:SPINT1 (NM_001032367) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303537 SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_001027539) 10 ug
$3,255.00
PH318993 SPINT1 MS Standard C13 and N15-labeled recombinant protein (NP_857593) 10 ug
$3,255.00
LC405735 SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422310 SPINT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405735 Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1 100 ug
$665.00
LY422310 Transient overexpression lysate of serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 3 100 ug
$436.00
TP318993 Recombinant protein of human serine peptidase inhibitor, Kunitz type 1 (SPINT1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.