BDNF (NM_170734) Human Recombinant Protein
SKU
TP317124
Recombinant protein of human brain-derived neurotrophic factor (BDNF), transcript variant 6, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC217124 representing NM_170734
Red=Cloning site Green=Tags(s) MQSREEEWFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRG LTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMR VRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG CRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_733930 |
Locus ID | 627 |
UniProt ID | P23560 |
Cytogenetics | 11p14.1 |
RefSeq Size | 3958 |
RefSeq ORF | 786 |
Synonyms | ANON2; BULN2 |
Summary | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Transmembrane |
Protein Pathways | Huntington's disease, MAPK signaling pathway, Neurotrophin signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317124 | BDNF MS Standard C13 and N15-labeled recombinant protein (NP_733930) | 10 ug |
$3,255.00
|
|
LC400640 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC403526 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC403537 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406735 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406736 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406855 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428351 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428352 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428353 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428354 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428355 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428357 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428358 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428359 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428360 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428362 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400640 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 4 | 100 ug |
$436.00
|
|
LY403526 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 6 | 100 ug |
$436.00
|
|
LY403537 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 3 | 100 ug |
$436.00
|
|
LY406735 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 2 | 100 ug |
$436.00
|
|
LY406736 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 5 | 100 ug |
$436.00
|
|
LY406855 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 1 | 100 ug |
$436.00
|
|
LY428351 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 7 | 100 ug |
$436.00
|
|
LY428352 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 8 | 100 ug |
$436.00
|
|
LY428353 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 9 | 100 ug |
$436.00
|
|
LY428354 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 10 | 100 ug |
$436.00
|
|
LY428355 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 17 | 100 ug |
$436.00
|
|
LY428357 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 11 | 100 ug |
$436.00
|
|
LY428358 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 12 | 100 ug |
$436.00
|
|
LY428359 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 13 | 100 ug |
$436.00
|
|
LY428360 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 14 | 100 ug |
$436.00
|
|
LY428362 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 16 | 100 ug |
$436.00
|
|
TP720589 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 | 10 ug |
$330.00
|
|
TP720590 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 | 10 ug |
$265.00
|
|
TP762592 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 4, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.