GALK2 (NM_001001556) Human Recombinant Protein

SKU
TP316527
Recombinant protein of human galactokinase 2 (GALK2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216527 representing NM_001001556
Red=Cloning site Green=Tags(s)

MPVLYDRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAVEPVKTYALQL
ANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPPSSGLSSSSALV
CCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGA
VFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALH
PEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLG
ELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQR
SDGSLAPEKQSLFATKPGGGALVLLEA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001556
Locus ID 2585
UniProt ID Q01415
Cytogenetics 15q21.1-q21.2
RefSeq Size 3208
RefSeq ORF 1341
Synonyms GK2
Summary This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. The encoded protein is a member of the GHMP kinase family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2017]
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:GALK2 (NM_001001556) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300475 GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_002035) 10 ug
$3,255.00
PH316527 GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_001001556) 10 ug
$3,255.00
LC400749 GALK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424379 GALK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400749 Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 1 100 ug
$436.00
LY424379 Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 2 100 ug
$665.00
TP300475 Recombinant protein of human galactokinase 2 (GALK2), transcript variant 1, 20 µg 20 ug
$737.00
TP721055 Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.