GALK2 (NM_001001556) Human Mass Spec Standard

SKU
PH316527
GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_001001556)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216527]
Predicted MW 49.1 kDa
Protein Sequence
Protein Sequence
>RC216527 representing NM_001001556
Red=Cloning site Green=Tags(s)

MPVLYDRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAVEPVKTYALQL
ANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPPSSGLSSSSALV
CCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGA
VFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALH
PEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLG
ELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQR
SDGSLAPEKQSLFATKPGGGALVLLEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001556
RefSeq Size 3208
RefSeq ORF 1341
Synonyms GK2
Locus ID 2585
UniProt ID Q01415
Cytogenetics 15q21.1-q21.2
Summary This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. The encoded protein is a member of the GHMP kinase family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2017]
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:GALK2 (NM_001001556) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300475 GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_002035) 10 ug
$3,255.00
LC400749 GALK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424379 GALK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400749 Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 1 100 ug
$436.00
LY424379 Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 2 100 ug
$665.00
TP300475 Recombinant protein of human galactokinase 2 (GALK2), transcript variant 1, 20 µg 20 ug
$737.00
TP316527 Recombinant protein of human galactokinase 2 (GALK2), transcript variant 2, 20 µg 20 ug
$737.00
TP721055 Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.