C1orf86 (FAAP20) (NM_182533) Human Recombinant Protein

SKU TP315561

Recombinant protein of human chromosome 1 open reading frame 86 (C1orf86), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215561 representing NM_182533; Red=Cloning site Green=Tags(s); ; MEAARRPRLGLSRRRPPPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRC; GPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEG; AAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_872339
• Locus ID: 199990
• UniProt ID: Q6NZ36
• Cytogenetics: 1p36.33
• RefSeq Size: 745
• RefSeq ORF: 540
• Synonyms: C1orf86; FP7162
• Summary: Component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. Promotes translesion synthesis via interaction with REV1.[UniProtKB/Swiss-Prot Function]