C1orf86 (FAAP20) (NM_182533) Human Mass Spec Standard

SKU
PH315561
C1orf86 MS Standard C13 and N15-labeled recombinant protein (NP_872339)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215561]
Predicted MW 19.6 kDa
Protein Sequence
Protein Sequence
>RC215561 representing NM_182533
Red=Cloning site Green=Tags(s)

MEAARRPRLGLSRRRPPPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRC
GPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEG
AAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872339
RefSeq Size 745
RefSeq ORF 540
Synonyms C1orf86; FP7162
Locus ID 199990
UniProt ID Q6NZ36
Cytogenetics 1p36.33
Summary Component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. Promotes translesion synthesis via interaction with REV1.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C1orf86 (FAAP20) (NM_182533) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405510 C1orf86 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405510 Transient overexpression lysate of chromosome 1 open reading frame 86 (C1orf86), transcript variant 2 100 ug
$436.00
TP315561 Recombinant protein of human chromosome 1 open reading frame 86 (C1orf86), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.