C1orf86 (FAAP20) Rabbit Polyclonal Antibody

SKU TA334802

Rabbit Polyclonal Anti-C1orf86 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf86 antibody is: synthetic peptide directed towards the C-terminal region of Human C1orf86. Synthetic peptide located within the following region: ARSLPQRPAPDPCRAPRVEQQPSVEGAAALRSCPMCQKEFAPRLTQLDVD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: Fanconi anemia core complex associated protein 20
• Database Link:
  NP_872339
  Q6NZ36
• Background: C1orf86 is a component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. It promotes translesion synthesis via interaction with REV1.
• Synonyms: C1orf86; FP7162
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data