BTNL8 (NM_001040462) Human Recombinant Protein

SKU
TP315370
Purified recombinant protein of Homo sapiens butyrophilin-like 8 (BTNL8), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215370 representing NM_001040462
Red=Cloning site Green=Tags(s)

MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDG
KDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLI
SITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRH
AHLSREVESRVQIGDTFFEPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQWKIQAELDWRRKHGQAEL
RDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHN
KRWRVGVCRDDVDRRKEYVTLSPDHGYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISF
FNINDQSLIYTLTCRFEGLLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA
TTPFLPRGEM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035552
Locus ID 79908
UniProt ID Q6UX41
Cytogenetics 5q35.3
RefSeq Size 2052
RefSeq ORF 1500
Synonyms BTN9.2
Summary May stimulate primary immune response. Acts on T-cell stimulated sub-optimally through the TCR/CD3 complex stimulating their proliferation and cytokine production.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:BTNL8 (NM_001040462) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315370 BTNL8 MS Standard C13 and N15-labeled recombinant protein (NP_001035552) 10 ug
$3,255.00
LC411020 BTNL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431298 BTNL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431331 BTNL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411020 Transient overexpression lysate of butyrophilin-like 8 (BTNL8), transcript variant 1 100 ug
$436.00
LY431298 Transient overexpression lysate of butyrophilin-like 8 (BTNL8), transcript variant 4 100 ug
$436.00
LY431331 Transient overexpression lysate of butyrophilin-like 8 (BTNL8), transcript variant 5 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.