BTNL8 Rabbit Polyclonal Antibody

SKU TA338684

Rabbit Polyclonal Anti-BTNL8 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTNL8 antibody: synthetic peptide directed towards the N terminal of human BTNL8. Synthetic peptide located within the following region: MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: butyrophilin like 8
• Database Link:
  NP_001035552
  Q6UX41
• Background: BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown.
• Synonyms: BTN9.2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane