BTNL8 (NM_001040462) Human Mass Spec Standard

SKU
PH315370
BTNL8 MS Standard C13 and N15-labeled recombinant protein (NP_001035552)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215370]
Predicted MW 56.6 kDa
Protein Sequence
Protein Sequence
>RC215370 representing NM_001040462
Red=Cloning site Green=Tags(s)

MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDG
KDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLI
SITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRH
AHLSREVESRVQIGDTFFEPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQWKIQAELDWRRKHGQAEL
RDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHN
KRWRVGVCRDDVDRRKEYVTLSPDHGYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISF
FNINDQSLIYTLTCRFEGLLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA
TTPFLPRGEM

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035552
RefSeq Size 2052
RefSeq ORF 1500
Synonyms BTN9.2
Locus ID 79908
UniProt ID Q6UX41
Cytogenetics 5q35.3
Summary May stimulate primary immune response. Acts on T-cell stimulated sub-optimally through the TCR/CD3 complex stimulating their proliferation and cytokine production.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:BTNL8 (NM_001040462) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411020 BTNL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431298 BTNL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431331 BTNL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411020 Transient overexpression lysate of butyrophilin-like 8 (BTNL8), transcript variant 1 100 ug
$436.00
LY431298 Transient overexpression lysate of butyrophilin-like 8 (BTNL8), transcript variant 4 100 ug
$436.00
LY431331 Transient overexpression lysate of butyrophilin-like 8 (BTNL8), transcript variant 5 100 ug
$436.00
TP315370 Purified recombinant protein of Homo sapiens butyrophilin-like 8 (BTNL8), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.