Amyloid Precursor Protein (APP) (NM_201414) Human Recombinant Protein

SKU
TP315147
Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215147 representing NM_201414
Red=Cloning site Green=Tags(s)

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW
GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT
ESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPK
ADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLK
KYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDEL
LQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTEN
EVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
MVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 76.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_958817
Locus ID 351
UniProt ID P05067
Cytogenetics 21q21.3
RefSeq Size 3416
RefSeq ORF 2085
Synonyms AAA; ABETA; ABPP; AD1; alpha-sAPP; APPI; CTFgamma; CVAP; PN-II; PN2; preA4
Summary This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Alzheimer's disease
Write Your Own Review
You're reviewing:Amyloid Precursor Protein (APP) (NM_201414) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309575 APP MS Standard C13 and N15-labeled recombinant protein (NP_958816) 10 ug
$3,255.00
PH315147 APP MS Standard C13 and N15-labeled recombinant protein (NP_958817) 10 ug
$3,255.00
LC404408 APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404409 APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424694 APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427815 APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404408 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 100 ug
$436.00
LY404409 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 3 100 ug
$665.00
LY424694 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 1 100 ug
$665.00
LY427815 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 5 100 ug
$436.00
TP309575 Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.