beta Catenin (CTNNB1) (NM_001098210) Human Recombinant Protein
SKU
TP314557
Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), 20 µg
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC214557 representing NM_001098210
Red=Cloning site Green=Tags(s) MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGF SQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLI NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVET ARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQ KMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG LPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQF VEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEA IEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI GAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGD SNQLAWFDTDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 85.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001091680 |
Locus ID | 1499 |
UniProt ID | P35222 |
Cytogenetics | 3p22.1 |
RefSeq Size | 3256 |
RefSeq ORF | 2343 |
Synonyms | armadillo; CTNNB; EVR7; MRD19; NEDSDV |
Summary | The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Focal adhesion, Leukocyte transendothelial migration, Melanogenesis, Pathogenic Escherichia coli infection, Pathways in cancer, Prostate cancer, Thyroid cancer, Tight junction, Wnt signaling pathway |
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308947 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001895) | 10 ug |
$3,255.00
|
|
PH312056 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001091679) | 10 ug |
$3,255.00
|
|
PH314557 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001091680) | 10 ug |
$3,255.00
|
|
LC419662 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420557 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420558 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC426005 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY419662 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1 | 100 ug |
$436.00
|
|
LY420557 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2 | 100 ug |
$665.00
|
|
LY420558 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 3 | 100 ug |
$665.00
|
|
LY426005 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2 | 100 ug |
$665.00
|
|
TP308947 | Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), 20 µg | 20 ug |
$867.00
|
|
TP312056 | Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), 20 µg | 20 ug |
$867.00
|
|
TP710027 | Recombinant protein of human human catenin (cadherin-associated protein), beta 1(CTNNB1), full length, with C-terminal DDK tag, expressed in sf9 cells | 20 ug |
$515.00
|
|
TP710124 | Recombinant protein of human human catenin (cadherin-associated protein), beta 1(CTNNB1), full length, with N-terminal His tag, expressed in sf9 cells | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.