Parvalbumin (PVALB) (NM_002854) Human Recombinant Protein
SKU
TP312427
Recombinant protein of human parvalbumin (PVALB), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC212427 protein sequence
Red=Cloning site Green=Tags(s) MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002845 |
Locus ID | 5816 |
UniProt ID | P20472 |
Cytogenetics | 22q12.3 |
RefSeq Size | 586 |
RefSeq ORF | 330 |
Synonyms | D22S749 |
Summary | The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312427 | PVALB MS Standard C13 and N15-labeled recombinant protein (NP_002845) | 10 ug |
$3,255.00
|
|
LC419082 | PVALB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419082 | Transient overexpression lysate of parvalbumin (PVALB) | 100 ug |
$436.00
|
|
TP720135 | Recombinant protein of human parvalbumin (PVALB) | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.