Parvalbumin (PVALB) (NM_002854) Human Recombinant Protein

SKU
TP312427
Recombinant protein of human parvalbumin (PVALB), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212427 protein sequence
Red=Cloning site Green=Tags(s)

MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG
FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002845
Locus ID 5816
UniProt ID P20472
Cytogenetics 22q12.3
RefSeq Size 586
RefSeq ORF 330
Synonyms D22S749
Summary The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:Parvalbumin (PVALB) (NM_002854) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312427 PVALB MS Standard C13 and N15-labeled recombinant protein (NP_002845) 10 ug
$3,255.00
LC419082 PVALB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419082 Transient overexpression lysate of parvalbumin (PVALB) 100 ug
$436.00
TP720135 Recombinant protein of human parvalbumin (PVALB) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.