Parvalbumin (PVALB) (NM_002854) Human Tagged ORF Clone

SKU
RC212427
PVALB (Myc-DDK-tagged)-Human parvalbumin (PVALB)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Parvalbumin
Synonyms D22S749
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212427 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGATGACAGACTTGCTGAACGCTGAGGACATCAAGAAGGCGGTGGGAGCCTTTAGCGCTACCGACT
CCTTCGACCACAAAAAGTTCTTCCAAATGGTCGGCCTGAAGAAAAAGAGTGCGGATGATGTGAAGAAGGT
GTTTCACATGCTGGACAAGGACAAAAGTGGCTTCATCGAGGAGGATGAGCTGGGATTCATCCTAAAAGGC
TTCTCCCCAGATGCCAGAGACCTGTCTGCTAAAGAAACCAAGATGCTGATGGCTGCTGGAGACAAAGATG
GGGACGGCAAAATTGGGGTTGACGAATTCTCCACTCTGGTGGCTGAAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212427 protein sequence
Red=Cloning site Green=Tags(s)

MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG
FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002854
ORF Size 330 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002854.3
RefSeq Size 586 bp
RefSeq ORF 333 bp
Locus ID 5816
UniProt ID P20472
Cytogenetics 22q12.3
MW 12.1 kDa
Summary The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:Parvalbumin (PVALB) (NM_002854) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212427L1 Lenti ORF clone of Human parvalbumin (PVALB), Myc-DDK-tagged 10 ug
$450.00
RC212427L2 Lenti ORF clone of Human parvalbumin (PVALB), mGFP tagged 10 ug
$450.00
RC212427L3 Lenti ORF clone of Human parvalbumin (PVALB), Myc-DDK-tagged 10 ug
$450.00
RC212427L4 Lenti ORF clone of Human parvalbumin (PVALB), mGFP tagged 10 ug
$450.00
RG212427 PVALB (tGFP-tagged) - Human parvalbumin (PVALB) 10 ug
$489.00
SC303247 PVALB (untagged)-Human parvalbumin (PVALB) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.