Parvalbumin (PVALB) (NM_002854) Human Mass Spec Standard

SKU PH312427

PVALB MS Standard C13 and N15-labeled recombinant protein (NP_002845)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC212427]
• Predicted MW: 12.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC212427 protein sequence; Red=Cloning site Green=Tags(s); ; MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG; FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002845
• RefSeq Size: 586
• RefSeq ORF: 330
• Synonyms: D22S749
• Locus ID: 5816
• UniProt ID: P20472
• Cytogenetics: 22q12.3
• Summary: The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]