Parvalbumin (PVALB) (NM_002854) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC212427] |
Predicted MW | 12.1 kDa |
Protein Sequence |
Protein Sequence
>RC212427 protein sequence
Red=Cloning site Green=Tags(s) MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002845 |
RefSeq Size | 586 |
RefSeq ORF | 330 |
Synonyms | D22S749 |
Locus ID | 5816 |
UniProt ID | P20472 |
Cytogenetics | 22q12.3 |
Summary | The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC419082 | PVALB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419082 | Transient overexpression lysate of parvalbumin (PVALB) | 100 ug |
$436.00
|
|
TP312427 | Recombinant protein of human parvalbumin (PVALB), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720135 | Recombinant protein of human parvalbumin (PVALB) | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.