HES1 (NM_005524) Human Recombinant Protein

SKU
TP311709
Recombinant protein of human hairy and enhancer of split 1, (Drosophila) (HES1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211709 representing NM_005524
Red=Cloning site Green=Tags(s)

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS
RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL
GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG
EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005515
Locus ID 3280
UniProt ID Q14469
Cytogenetics 3q29
RefSeq Size 1471
RefSeq ORF 840
Synonyms bHLHb39; HES-1; HHL; HRY
Summary This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq, Jul 2008]
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transcription Factors
Protein Pathways Maturity onset diabetes of the young, Notch signaling pathway
Write Your Own Review
You're reviewing:HES1 (NM_005524) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH311709 HES1 MS Standard C13 and N15-labeled recombinant protein (NP_005515) 10 ug
$3,255.00
LC417251 HES1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417251 Transient overexpression lysate of hairy and enhancer of split 1, (Drosophila) (HES1) 100 ug
$436.00
TP760671 Purified recombinant protein of Human hairy and enhancer of split 1, (Drosophila) (HES1), with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.