HES1 (NM_005524) Human Tagged ORF Clone

SKU
RC211709
HES1 (Myc-DDK-tagged)-Human hairy and enhancer of split 1, (Drosophila) (HES1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HES1
Synonyms bHLHb39; HES-1; HHL; HRY
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211709 representing NM_005524
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGCTGATATAATGGAGAAAAATTCCTCGTCCCCGGTGGCTGCTACCCCAGCCAGTGTCAACACGA
CACCGGATAAACCAAAGACAGCATCTGAGCACAGAAAGTCATCAAAGCCTATTATGGAGAAAAGACGAAG
AGCAAGAATAAATGAAAGTCTGAGCCAGCTGAAAACACTGATTTTGGATGCTCTGAAGAAAGATAGCTCG
CGGCATTCCAAGCTGGAGAAGGCGGACATTCTGGAAATGACAGTGAAGCACCTCCGGAACCTGCAGCGGG
CGCAGATGACGGCTGCGCTGAGCACAGACCCAAGTGTGCTGGGGAAGTACCGAGCCGGCTTCAGCGAGTG
CATGAACGAGGTGACCCGCTTCCTGTCCACGTGCGAGGGCGTTAATACCGAGGTGCGCACTCGGCTGCTC
GGCCACCTGGCCAACTGCATGACCCAGATCAATGCCATGACCTACCCCGGGCAGCCGCACCCCGCCTTGC
AGGCGCCGCCACCGCCCCCACCGGGACCCGGCGGCCCCCAGCACGCGCCGTTCGCGCCGCCGCCGCCACT
CGTGCCCATCCCCGGGGGCGCGGCGCCCCCTCCCGGCGGCGCCCCCTGCAAGCTGGGCAGCCAGGCTGGA
GAGGCGGCTAAGGTGTTTGGAGGCTTCCAGGTGGTACCGGCTCCCGATGGCCAGTTTGCTTTCCTCATTC
CCAACGGGGCCTTCGCGCACAGCGGCCCTGTCATCCCCGTCTACACCAGCAACAGCGGCACCTCCGTGGG
CCCCAACGCAGTGTCACCTTCCAGCGGCCCCTCGCTTACGGCGGACTCCATGTGGAGGCCGTGGCGGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211709 representing NM_005524
Red=Cloning site Green=Tags(s)

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS
RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL
GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG
EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005524
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005524.4
RefSeq Size 1471 bp
RefSeq ORF 843 bp
Locus ID 3280
UniProt ID Q14469
Cytogenetics 3q29
Domains HLH, ORANGE
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transcription Factors
Protein Pathways Maturity onset diabetes of the young, Notch signaling pathway
MW 29.4 kDa
Summary This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HES1 (NM_005524) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211709L1 Lenti ORF clone of Human hairy and enhancer of split 1, (Drosophila) (HES1), Myc-DDK-tagged 10 ug
$600.00
RC211709L2 Lenti ORF clone of Human hairy and enhancer of split 1, (Drosophila) (HES1), mGFP tagged 10 ug
$600.00
RC211709L3 Lenti ORF clone of Human hairy and enhancer of split 1, (Drosophila) (HES1), Myc-DDK-tagged 10 ug
$600.00
RC211709L4 Lenti ORF clone of Human hairy and enhancer of split 1, (Drosophila) (HES1), mGFP tagged 10 ug
$600.00
RG211709 HES1 (tGFP-tagged) - Human hairy and enhancer of split 1, (Drosophila) (HES1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116707 HES1 (untagged)-Human hairy and enhancer of split 1, (Drosophila) (HES1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.