NIT1 (NM_005600) Human Recombinant Protein
SKU
TP311519
Recombinant protein of human nitrilase 1 (NIT1), 20 µg
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC211519 representing NM_005600
Red=Cloning site Green=Tags(s) MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005591 |
Locus ID | 4817 |
UniProt ID | Q86X76 |
Cytogenetics | 1q23.3 |
RefSeq Size | 1385 |
RefSeq ORF | 981 |
Summary | This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH311519 | NIT1 MS Standard C13 and N15-labeled recombinant protein (NP_005591) | 10 ug |
$3,255.00
|
|
LC401717 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC433784 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434153 | NIT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401717 | Transient overexpression lysate of nitrilase 1 (NIT1) | 100 ug |
$436.00
|
|
LY433784 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 2 | 100 ug |
$436.00
|
|
LY434153 | Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 3 | 100 ug |
$436.00
|
|
TP331154 | Purified recombinant protein of Homo sapiens nitrilase 1 (NIT1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations |
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.