NIT1 (NM_005600) Human Mass Spec Standard

SKU
PH311519
NIT1 MS Standard C13 and N15-labeled recombinant protein (NP_005591)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211519]
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC211519 representing NM_005600
Red=Cloning site Green=Tags(s)

MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL
VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ
KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE
LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT
VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005591
RefSeq Size 1385
RefSeq ORF 981
Locus ID 4817
UniProt ID Q86X76
Cytogenetics 1q23.3
Summary This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:NIT1 (NM_005600) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401717 NIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433784 NIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434153 NIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401717 Transient overexpression lysate of nitrilase 1 (NIT1) 100 ug
$436.00
LY433784 Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 2 100 ug
$436.00
LY434153 Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 3 100 ug
$436.00
TP311519 Recombinant protein of human nitrilase 1 (NIT1), 20 µg 20 ug
$737.00
TP331154 Purified recombinant protein of Homo sapiens nitrilase 1 (NIT1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.