OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NIT1 (NM_005600) Human Mass Spec Standard

Be the first to review this product
SKU
PH311519
NIT1 MS Standard C13 and N15-labeled recombinant protein (NP_005591)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501084 Anti-NIT1 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11) 100 ul
$447.00
LY401717 Transient overexpression lysate of nitrilase 1 (NIT1) (as WB positive control) 100 ug
$436.00

Other products for "NIT1 or NM_005600"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211519
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC211519 representing NM_005600
Red=Cloning site Green=Tags(s)

MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL
VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ
KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE
LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT
VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005591
RefSeq Size 1385
RefSeq ORF 981
Locus ID 4817
UniProt ID Q86X76
Cytogenetics 1q23.3
Summary This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jun 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NIT1" proteins (8)
SKU Description Size Price
LC401717 Lyophilized NIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433784 Lyophilized NIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434153 Lyophilized NIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401717 Transient overexpression lysate of nitrilase 1 (NIT1) (as WB positive control) 100 ug
$436.00
LY433784 Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY434153 Transient overexpression lysate of nitrilase 1 (NIT1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP311519 Recombinant protein of human nitrilase 1 (NIT1), 20 µg 20 ug
$737.00
TP331154 Purified recombinant protein of Homo sapiens nitrilase 1 (NIT1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products