NUP50 (NM_007172) Human Recombinant Protein

SKU
TP309975
Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209975 protein sequence
Red=Cloning site Green=Tags(s)

MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGG
GRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQP
SSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSES
ESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSS
VLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVT
EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG
KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009103
Locus ID 10762
UniProt ID Q9UKX7
Cytogenetics 22q13.31
RefSeq Size 5225
RefSeq ORF 1404
Synonyms NPAP60; NPAP60L
Summary The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Stem cell - Pluripotency
Write Your Own Review
You're reviewing:NUP50 (NM_007172) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307001 NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_705931) 10 ug
$3,255.00
PH309975 NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_009103) 10 ug
$3,255.00
LC407000 NUP50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416145 NUP50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407000 Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 3 100 ug
$436.00
LY416145 Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 2 100 ug
$436.00
TP307001 Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.