NUP50 (NM_153645) Human Mass Spec Standard

SKU
PH307001
NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_705931)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207001]
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC207001 protein sequence
Red=Cloning site Green=Tags(s)

MASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGGGRFSGFGSGAGGKPLEGLSNGNNITSAP
PFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQPSSSGLASSKACVGNAYHKQLAALNCSVR
DWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSESESNKVAAETQSPSLFGSTKLQQESTFLF
HGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTT
QSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGI
GTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIR
VKTSEDADELHKILLEKKDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_705931
RefSeq Size 5051
RefSeq ORF 1320
Synonyms NPAP60; NPAP60L
Locus ID 10762
UniProt ID Q9UKX7
Cytogenetics 22q13.31
Summary The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Stem cell - Pluripotency
Write Your Own Review
You're reviewing:NUP50 (NM_153645) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309975 NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_009103) 10 ug
$3,255.00
LC407000 NUP50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416145 NUP50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407000 Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 3 100 ug
$436.00
LY416145 Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 2 100 ug
$436.00
TP307001 Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 3, 20 µg 20 ug
$737.00
TP309975 Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.