ZFAND5 (NM_006007) Human Recombinant Protein

SKU
TP309943
Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209943 protein sequence
Red=Cloning site Green=Tags(s)

MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD
TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE
EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI
QRI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005998
Locus ID 7763
UniProt ID O76080
Cytogenetics 9q21.13
RefSeq Size 5747
RefSeq ORF 639
Synonyms ZA20D2; ZFAND5A; ZNF216
Summary Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZFAND5 (NM_006007) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309943 ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_005998) 10 ug
$3,255.00
PH321072 ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095890) 10 ug
$3,255.00
PH321129 ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095891) 10 ug
$3,255.00
LC416931 ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420147 ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420148 ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416931 Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c 100 ug
$436.00
LY420147 Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a 100 ug
$436.00
LY420148 Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b 100 ug
$436.00
TP321072 Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321129 Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710147 Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.