ZFAND5 (NM_006007) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC209943] |
Predicted MW | 23.1 kDa |
Protein Sequence |
Protein Sequence
>RC209943 protein sequence
Red=Cloning site Green=Tags(s) MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI QRI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005998 |
RefSeq Size | 5747 |
RefSeq ORF | 639 |
Synonyms | ZA20D2; ZFAND5A; ZNF216 |
Locus ID | 7763 |
UniProt ID | O76080 |
Cytogenetics | 9q21.13 |
Summary | Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321072 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095890) | 10 ug |
$3,255.00
|
|
PH321129 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095891) | 10 ug |
$3,255.00
|
|
LC416931 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420147 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420148 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416931 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c | 100 ug |
$436.00
|
|
LY420147 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a | 100 ug |
$436.00
|
|
LY420148 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b | 100 ug |
$436.00
|
|
TP309943 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP321072 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP321129 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP710147 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, full length, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.