ZFAND5 (NM_001102420) Human Mass Spec Standard

SKU
PH321072
ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095890)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221072]
Predicted MW 23.1 kDa
Protein Sequence
Protein Sequence
>RC221072 protein sequence
Red=Cloning site Green=Tags(s)

MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD
TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE
EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI
QRI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001095890
RefSeq Size 5887
RefSeq ORF 639
Synonyms ZA20D2; ZFAND5A; ZNF216
Locus ID 7763
UniProt ID O76080
Cytogenetics 9q21.13
Summary Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZFAND5 (NM_001102420) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309943 ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_005998) 10 ug
$3,255.00
PH321129 ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095891) 10 ug
$3,255.00
LC416931 ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420147 ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420148 ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416931 Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c 100 ug
$436.00
LY420147 Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a 100 ug
$436.00
LY420148 Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b 100 ug
$436.00
TP309943 Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321072 Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321129 Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710147 Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.